PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00883.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 234aa    MW: 26466.8 Da    PI: 5.7503
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00883.1_g00016.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.67.6e-4351352127
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgy 82 
                              + GfrF Pt++elvv+yL++++egk+  ++++vi+ +di++veP++Lp+    ++++++++w+fF++r++++a+g r++r+t sgy
  Rsa1.0_00883.1_g00016.1   5 TTGFRFYPTEDELVVFYLRNQLEGKSgDSMHRVIPVLDIFEVEPSHLPNiageRCRGDTEQWFFFVPRQEREARGGRPSRTTGSGY 90 
                              68***********************96667778***************656666666888************************** PP

                      NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                              Wkatg+  +v+sk+++ +g+kkt+vfy+g+ap+g kt+W m+ey+
  Rsa1.0_00883.1_g00016.1  91 WKATGSPGPVFSKDNRMIGVKKTMVFYTGKAPTGGKTKWKMNEYK 135
                              ********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-463161IPR003441NAC domain
PROSITE profilePS5100546.5314161IPR003441NAC domain
PfamPF023658.6E-236135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MEDLTTGFRF YPTEDELVVF YLRNQLEGKS GDSMHRVIPV LDIFEVEPSH LPNIAGERCR  60
GDTEQWFFFV PRQEREARGG RPSRTTGSGY WKATGSPGPV FSKDNRMIGV KKTMVFYTGK  120
APTGGKTKWK MNEYKALDDR DNISTIPKLR HEFSLCRVYI TSGSSRAFDR RPVGVLQTGR  180
MLTNDVAVAD TSIFVGSSPE ISMSGGEHVD LSVDTEMVDG LTEPIWEWEQ LNWP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-33416617170NO APICAL MERISTEM PROTEIN
1ut4_B1e-33416617170NO APICAL MERISTEM PROTEIN
1ut7_A1e-33416617170NO APICAL MERISTEM PROTEIN
1ut7_B1e-33416617170NO APICAL MERISTEM PROTEIN
3swm_A1e-33416620173NAC domain-containing protein 19
3swm_B1e-33416620173NAC domain-containing protein 19
3swm_C1e-33416620173NAC domain-containing protein 19
3swm_D1e-33416620173NAC domain-containing protein 19
3swp_A1e-33416620173NAC domain-containing protein 19
3swp_B1e-33416620173NAC domain-containing protein 19
3swp_C1e-33416620173NAC domain-containing protein 19
3swp_D1e-33416620173NAC domain-containing protein 19
4dul_A1e-33416617170NAC domain-containing protein 19
4dul_B1e-33416617170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627314.11e-166PREDICTED: NAC domain-containing protein 90-like
RefseqXP_013680562.11e-166PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR31e-145NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A078JT761e-166A0A078JT76_BRANA; BnaCnng60710D protein
TrEMBLA0A0D3B2A71e-166A0A0D3B2A7_BRAOL; Uncharacterized protein
STRINGBra006624.1-P1e-160(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14452893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-135NAC domain containing protein 90